SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L8H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L8H5
Domain Number 1 Region: 39-162
Classification Level Classification E-value
Superfamily TIMP-like 1.3e-23
Family Netrin-like domain (NTR/C345C module) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091L8H5
Sequence length 171
Comment (tr|A0A091L8H5|A0A091L8H5_CATAU) Secreted frizzled-related protein 5 {ECO:0000313|EMBL:KFP51505.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_05656 OC=Cathartes.
Sequence
YGFPWPEMLHCGKFPSDHELCIAVQFGNSKATPPPVSKICTQCEMEHKADGMMEQMCSSD
FVVKMRIKEMTEENGERRLVAAQKKKVLKLGPLKRKDTKKMVLHMRNAAACPFFFLSGSF
LVMGRKVGGRLLLLAVYPWQKHNKEMKFAVKFMFSYPCPLYHPLLYGAGQH
Download sequence
Identical sequences A0A091L8H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]