SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LAW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LAW8
Domain Number 1 Region: 180-274
Classification Level Classification E-value
Superfamily Immunoglobulin 6.68e-16
Family I set domains 0.053
Further Details:      
 
Domain Number 2 Region: 28-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 103-177
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000824
Family Pre-dockerin domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091LAW8
Sequence length 1019
Comment (tr|A0A091LAW8|A0A091LAW8_CATAU) Cartilage intermediate layer protein 1 {ECO:0000313|EMBL:KFP53037.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_10297 OC=Cathartes.
Sequence
GTRSSSHRGVPTFTYARRSPLVQDSKRFLSPWSKWSECSAKCGQTGVQKRTRSCLAERLW
GTHCNEATEEGRLCVGHVCSACTISCPMGRVNADCDACMCEDATLHGKVSLEDGSPAADA
RVYLQAKKLKLLTTADNRGMFRIPGVCPDGKNTLKIKKAKYATATVTVPESNRRNLAIEV
QLQRSGKPYIFRSPEDKARRVGQSVSLCCDALGSPAPDRYLWYHNGSLLDPSLYKYKNNL
VLKNLKRDQSGEYFCKASSAGGSAKSQSAKLAVIGRQEAACNSQPQSHLIQLPHDCFQKA
TNSFYYDVGKCPAKTCAGKLDKGLRCKDNVAYCCGVSKMETRDISCNGYTLPTKVVVECG
CKKCTETKITVRGRATAADNGEPLRFGHIYMGNKRVSMTGYKGTFSIHVPADTERLVLTF
VDRLQKFVNTTKVLPFKENGGAVFHEIKLLRKKAPVTLESTETNVISLGEMEEDDPIAEL
EIPPNAFYRKNGEAYRGKVKASVTFLDPRNISTAAVTQSDLNFVDEEGDIFPLRTYGMFS
VDFTDEWGTESLNAEEVKVHLDAAQVKMPEHLQEMKLWSLNPETGLWEEEGDFNLEKSRR
RKREERTFLVGNMEIKERRLFNLDVPESRRCYVKVRAYRSERFLQSEQIQGVVISVINME
PEPGFSSNPRAWGRFDSVVTGPNGACVPAFCDEQNPEAYTAYILASMGGEELEAVSSAPK
LNPNAIGVPQPYLNKLNYRRTDHEDSNTKKTAFSINMAKPSPNSPEENDGPIYAYENLRE
CEEAPHNAAHFRFYRIEGDRYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYIKVKIN
GPQEVNVRSRNMGGTHPRTIGKLYGIRDVRSIRDSEQPDVSAACLEFKCSGMLFDQDRVD
RTLVRVVPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGIYTVTD
QDPRIAKEIALGRCFDGTSDGTSRTMKSNIGVGLTFTCSERSAAEQSIFQSQRNSGQQS
Download sequence
Identical sequences A0A091LAW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]