SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LB31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LB31
Domain Number 1 Region: 16-85
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-21
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 2 Region: 88-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000309
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LB31
Sequence length 135
Comment (tr|A0A091LB31|A0A091LB31_9GRUI) Fibrillin-2 {ECO:0000313|EMBL:KFP40141.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_08331 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
CECPEGLTLDGTARTCVDVRVEQCYMKWDEDECTEPLPGKYRIDMCCCSVGSAWGIDCEE
CPKVGSSEYKAICPRGPGFANRGDVLSGRPFYKDVNECKVFSGLCTHGTCRNTIGSFRCL
CGNGFALDAEERNCT
Download sequence
Identical sequences A0A091LB31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]