SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LD69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LD69
Domain Number 1 Region: 16-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000487
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 173-217
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000981
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 79-121
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000022
Family Fibronectin type I module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091LD69
Sequence length 316
Comment (tr|A0A091LD69|A0A091LD69_9GRUI) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFP40891.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_05791 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
PSETGEVQQRKEICHWPCRCPPMPTCTPGVSLVKDGCGCCKVCAKQSGETCNEADICDPH
KGLYCDYSEDEPRYETGVCAYLVAVGCELNGVYYLNGQTFQPNPLYKCLCVSGAIGCTPV
FTPRVAASPCARVKGRKKPGQSTCGLGQHKQLQSTNYRLMSAYRSLPLVLKKKCLVQATP
WTPCSRTCGIGMSSRVTNENRKCEMKKEKRLCFIQPCLTNTLKTIKIPKGKTCQPTFQLP
TAEKLVFSGCSTTQSYKLTFCGVCLDKRCCIPNKSKMITVQFECPNEGFFKWKMMWITSC
VCQRICTAPGDLFSEL
Download sequence
Identical sequences A0A091LD69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]