SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LGU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LGU1
Domain Number 1 Region: 416-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000105
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LGU1
Sequence length 536
Comment (tr|A0A091LGU1|A0A091LGU1_CATAU) Regulator of G-protein signaling protein-like {ECO:0000313|EMBL:KFP54548.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_04202 OC=Cathartes.
Sequence
PLVATLASTDMGLLLRDDVFVDFFNTFLNLPVFGQTPIYISSTGRWDLWPELPSRLDPSP
SALLAWLEKHRLPHFCKSSLCLHFVLCQKLLGFIRSGEAAKLLNWQSADRWLLEKCISGS
QAMWRFRAFIQGMAGEELTNFWLTTERLLGLDESDARQRDLYLSLLHRLKATHLREGSSV
ITLCRTIAGLLPKARNVQPISTKREILSKMQERALFMIQSYWLPKFFIHCKKGMEEEKSC
WPLLQEYQERLLRANSQEPSGFSENLFTMHIKRSQGLSGPYCSMKAKVEIWTLVKEGRDT
QETKMPSFQVQPERQPAPAGSTKESHLDKDALGSIPQQSEHPANTAFGGKGGATSPKRPR
PNAEQVLHLEDLCEEEVPSNLRSSAPLVQLPSLKQPVNTLSFLAWALSAETCAGRPFRDF
LKRQDRSVETRLLDLWHDLEEFLPVALDPSKENSFFLRHLIGEKICQTYLEEGTIQQLPL
EMRTLRNLRDHLISGEFSPWIFRAQKEICKVLCCFYEEFLADDDRTFLQYMVKGMH
Download sequence
Identical sequences A0A091LGU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]