SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LJY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LJY2
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.72e-20
Family Thyroglobulin type-1 domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091LJY2
Sequence length 285
Comment (tr|A0A091LJY2|A0A091LJY2_CATAU) Epithelial cell adhesion molecule {ECO:0000313|EMBL:KFP57476.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_06679 OC=Cathartes.
Sequence
ACICEKNKRVMNCRVVNGVCWCDSVGSGVSVNCDSLTSKCLLMKAEVTGSKSGRREKPKG
AFEDTDGLYDPECENTGVFKAKQCSGTTCWCVNTAGVRRTDKHDADLKCNQLVRTTWIII
EMKHADRNVPLNTESLKKFFRETITNRYMLDGRYISSVLYEKPYITIDLKQNSSDKSSGD
VDIADVAYYFEKDVKGDSIFHNNRLNISIDNEMLHFEKTVVYYVDEIAPEFSMKSLTPGL
IAVIVVVIVAIVAAIVVLVFTRRRKGKYVKAEVKEMNEMHRGLNA
Download sequence
Identical sequences A0A091LJY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]