SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LLI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LLI8
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 220-369
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 3 Region: 8-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000207
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LLI8
Sequence length 1031
Comment (tr|A0A091LLI8|A0A091LLI8_CATAU) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFP58563.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_08738 OC=Cathartes.
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPTLCAGNSDNSAPKQRSFSISAAIKFE
TGNESVSNPNLLSKEEISKVLNDDSVFRTGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPNSIWENPVGRGQNQPASHWNGFCHEQEGNI
PLEVIQNDKSQNVSKHLSPSARIEVPLVSSRNSVPPSKKNATGIGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGPPHSIRKSKEDKKGAKFGHPMGLSQAPPPRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSADLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRRKSLG
KSQKRKENGDYPNDSIQSNGLSYRRESQGSMSSTASLDLSEASRLPAFVPDKEKSPKYCC
INLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFR
Download sequence
Identical sequences A0A091LLI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]