SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LQC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LQC6
Domain Number 1 Region: 98-308
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-57
Family Reprolysin-like 0.00094
Further Details:      
 
Domain Number 2 Region: 396-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 992-1049
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000196
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 4 Region: 1195-1254
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000772
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 916-975
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000837
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 1044-1105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 1430-1490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000107
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 8 Region: 1496-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 9 Region: 1144-1198
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 10 Region: 802-863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 11 Region: 1259-1313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000392
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 12 Region: 1311-1369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000641
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 13 Region: 863-918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 14 Region: 1365-1427
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 687-743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000419
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091LQC6
Sequence length 1749
Comment (tr|A0A091LQC6|A0A091LQC6_CARIC) A disintegrin and metalloproteinase with thrombospondin motifs 9 {ECO:0000313|EMBL:KFP60574.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_02616 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
LGTFKSDDGDYFVEPLLSLEEQEYEEEHNKPHLVYRHRTSPTSSSGDRQTCDTPESSILS
DIEMLKHSLEVNSFSADSNKTGNISEKKSHKRTKRFLSYPRFVEVMVVADSRMVAYHGAN
LQHYVLTLMSIVASIYKDPSIGNLINIVIVKLVVIHNEQDGPAISYNAQTTLKNFCQWQQ
SQNHPEGSHLQHDTAVLVTRQDICRAHDKCDTLGLAELGTVCDPYRSCSISEDNGLSTAF
TIAHELGHVFNMPHDDNHKCKEDGGKNQQHVMAPTLNFYTNPWMWSKCSRKYITEFLDTG
YGECLLDEPSSRTYTLPQQLPGLIYDVNKQCELIFGPGSQVCPYMMQCRRLWCINIDGAH
KGCRTQHTPWADGTECEPGKHCRFGMCVPKEREAPVIDGAWGTWSPFGTCSRTCGGGIKT
AIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCSKLKKDFRDEQCADFDGKHFNINGLPTN
VRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGPDTNDICVQGLCRQAGCD
HVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNVVVRIPAGATNIDVRQHSYSGKP
EDDNYLALSNSQGDFILNGDFVVSMFKREIKVGNAVIEYSGSDNTIERINSTDRIEQEIT
LQVLSVGNLYNPDVRYTFNIPIEDKPQQFYWNAYGPWQPCSKLCQGERKRKPVCTRESDQ
LTVSDQRCDRIPQPDPITEPCSTECELRWHIARKSECTAQCGLGYRTLEIYCSKYSRLEG
KIEKVDDRFCSSQPKPSTREKCTGDCNVGGWRYSAWTECSKSCGGGTRRRRAMCVNTYND
VLDDSKCSQQEKLTVQRCSDFLCPQWKTGDWSECLVTCGKGHKHRQTWCQFGEDRLNDRF
CDPETKPESVQTCQQQECASWQVGPWGQCTVTCGQGYQMRAVKCVVGTYVSVVDDNECNA
ATRPTDTQDCEIAACPPHPNSPEAKRSISGIHRTQWRFGSWTPCSATCGKGTRMRYVSCR
DDQGSVADESACFHLPKPSATEMCTVMPCGQWKALEWSSCSVTCGQGKATRQVICINYSD
QLVDRSECDPDDLPATEQDCSMSPCHPNSHDYGRPIHPFLYPDHRLKLHPGGSPNRNRAH
IPGGNQWRIGPWGACSSTCAGGFQRRVVVCQDENGYTASNCDEKSKPMEQRSCESGPCPQ
WAYGNWGECTKPCGAGTRTRLVVCQRPNGERFTDLSCEILDKPPDREQCNVQDCPRDAAW
SAGPWSSCSVSCGRGQKHRNVYCLSKEGRHVEEDYCKHLAKPNVQKKCRGGRCPKWKAGD
WGQCSVSCGRGVQRRTVHCQSGTSKAAEEAECDLASRPPPQRDCHLPECPTHHWAAGEWQ
ACMKTCGEASRYRKVVCVDENKQLQNSGYCDASKRPPEIESCGLPPCEYVWITGEWSECS
VTCGKGYRQRLVSCSEIYTGKDHYEYGYQNTVNCPGTQPPNIQPCYLGECPISASWRVGN
WGSCSVTCGVGVMHRSVQCLTNDDQVSSLCHADLKPEERRTCHNVHDCELPRSCKDVKNL
KSVTEDGEYFLQVKGKMLKVYCSGMQTDSPKEYVTLVNGDAENFSEVYGYRLHNPTECPY
NGSRREDCQCRKDYTAAGFSTFSKVRLDLNTMQIITTDLQFARTHDGRPVPYATAGDCYS
AAKCPQGRFSIDLYGTGLSLTGTAKWLSQGNYAVSEIQKSPDGTKVVGKCGGYCGKCTPS
SGTGLDVQV
Download sequence
Identical sequences A0A091LQC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]