SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LRA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LRA7
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LRA7
Sequence length 62
Comment (tr|A0A091LRA7|A0A091LRA7_CARIC) Zinc finger protein 398 {ECO:0000313|EMBL:KFP60869.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_07937 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
QVPVTFDDVSVYFNDKEWEKLEEWQKELYKNVMKGNYESLISLGKYGVSAPWRRQARRGS
WP
Download sequence
Identical sequences A0A091LRA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]