SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LS97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LS97
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily TNF-like 0.0000000000000239
Family TNF-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LS97
Sequence length 60
Comment (tr|A0A091LS97|A0A091LS97_CARIC) C1q-related factor {ECO:0000313|EMBL:KFP62368.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_05127 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
QVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNNNKYSTFSGFIIYSD
Download sequence
Identical sequences A0A091LS97 A0A091TMM2 A0A094KG93 R0LNR2
ENSAPLP00000001363 28377.ENSACAP00000007308 9031.ENSGALP00000028081 ENSGALP00000028081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]