SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LU56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LU56
Domain Number 1 Region: 81-301
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-51
Family Reprolysin-like 0.0031
Further Details:      
 
Domain Number 2 Region: 394-444
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 850-907
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 744-800
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 803-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 681-740
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091LU56
Sequence length 971
Comment (tr|A0A091LU56|A0A091LU56_CARIC) A disintegrin and metalloproteinase with thrombospondin motifs 17 {ECO:0000313|EMBL:KFP62716.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_08232 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
GQVGYIQIGSEHMLIQPVNTSETSFSGKEHFIRRRRSAKSSHPMKSHIPDEHCKVVAEKK
RQKKMKSTSDWRERRNAIRLTNEYTVETLVVADADMVKYHGAEAAQRFILTVMNMVYNMF
QHQSLGIKVSIRVTKLVLLHNRPAKLSIGHHGERSLESFCQWQNEEYGGAKYLGNNQVPG
ARDDTPPVDAAVFVTRTDFCVHKDEPCDTVGIAYLGGVCSAKRKCVLAEDNGLNLAFTIA
HELGHNMGMSHDDDHQPCAGRSHIMSGEWVKGRNPSDLSWSSCSRDDLENFLKSKVSTCL
LVTDPRSQYAVRLPHKLPGMHYSADEQCQILFGTNATFCKNMEHLMCAGLWCLVEGDTSC
KTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWSMWSQWSMCSRTCGTGVRFRQR
KCDNPPPGPGGKNCRGASVEHTVCENLPCPKGVPSFRDQQCQAHDRYTNKKKSLLTAVIV
DDKPCELFCSPLGKDSPVLVTDRVLDGTPCGPYETDLCVHGKCQKIGCDGIIGSAAKEDR
CGICSGDGKTCKVVKGDFNHTKGMGYIEAAVIPAGARRIRVVEDKPAHSFLALKDSSKRS
INSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKIPLHLMVLLFHDQNYGIHYEYT
IPVNYTAENRSEPEKQQDSLYIWTHSGWEGCSVQCGGGERKTIVSCTRIINKTMTVVNDS
DCQRVNRPEPQVRKCNTHPCQSRWVTGHWSPCSATCEKGVQHREVTCVYQLQNGTYVNTR
DLYCLGNKPTTVQSCEGRDCLSIWEASEWSKCSADCGKGIQKRTVTCTNSQGKCDAATRP
RDEEECEDHTGCYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGNECPVLSKPAAYR
QCHQEVCNEKINVNTITSPRLAALTYKCTGDQWTVYCRVIREKNLCQDMRWYQRCCQTCR
DFYANKMQLKS
Download sequence
Identical sequences A0A091LU56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]