SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LXT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LXT3
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-48
Family Regulator of G-protein signaling, RGS 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091LXT3
Sequence length 130
Comment (tr|A0A091LXT3|A0A091LXT3_CATAU) Regulator of G-protein signaling 3 {ECO:0000313|EMBL:KFP51116.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_02460 OC=Cathartes.
Sequence
RRPTPEEALKWGDSLEKLLLHKYGLAAFRAFLRTEFSEENLEFWLACEEFKKIKSQSKMV
SKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQKRIYGLMEKDSYPRF
LRSDLYLDII
Download sequence
Identical sequences A0A091LXT3 A0A091TQ80 A0A091ULL3 A0A093IUV1 A0A093Q8L9 A0A0A0AU70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]