SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091M5H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091M5H8
Domain Number 1 Region: 62-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000222
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000441
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 116-157
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091M5H8
Sequence length 159
Comment (tr|A0A091M5H8|A0A091M5H8_CATAU) Netrin receptor UNC5C {ECO:0000313|EMBL:KFP53791.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_05824 OC=Cathartes.
Sequence
KVEWLKNEEVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV
YVNGGWSTWTEWSVCNSRCGRGFQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDG
KWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCEGLV
Download sequence
Identical sequences A0A091M5H8 A0A093IVS2 A0A094K5D3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]