SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091M8N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091M8N6
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000153
Family Snake venom toxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091M8N6
Sequence length 109
Comment (tr|A0A091M8N6|A0A091M8N6_CATAU) Lymphocyte antigen 6E {ECO:0000313|EMBL:KFP54861.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_04071 OC=Cathartes.
Sequence
AHTLVCFSCSDASSNWACLTPVKCGENENHCVTTYVGVGIGSKSGQSISKGCSPICPSAG
INLGIASASVYCCDSFLCNISGSSSVKASYVVLALGVLVSFIYVLRARE
Download sequence
Identical sequences A0A091M8N6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]