SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MB56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MB56
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-39
Family Regulator of G-protein signaling, RGS 0.000000185
Further Details:      
 
Domain Number 2 Region: 760-841
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-27
Family DIX domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091MB56
Sequence length 841
Comment (tr|A0A091MB56|A0A091MB56_CARIC) Axin-1 {ECO:0000313|EMBL:KFP67794.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_05431 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
MNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSADPRPVSHGFYSGKSDVVRNETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLQIDPD
MFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPGYLPT
LNEDEEWKCDQEAEPEVSRDSAPSSRLTQKLLLETATQRAASARRYSEGREFRHGSWREP
VNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREMQESA
KANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVRAEE
EGEDADISSGPAVISHKMPSAQAFHHFAPRYSEMGCSGMQMRDAHEENPESILDEHVQRV
MKTPGCQSPGPGRHSPKPRSPESGHLGKLSGTLGTIPPGHGKHATKSGMKLDAANLYHHK
HIYHHIHHHSVMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYTENLGMAPVPMDSL
GYSGKASLLSKRNVKKTDSGKSDGANYEMPGSPEDVERNQKILQWIIEGEKEISRHKKTN
HGSSGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNVVQPSHPFIQDPTMPPNPAPNPLT
QLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGSGASQPCDNIVVAYYFCGEPIPYRTLVK
GRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVRDDDTILPIFEEKIIGKVEKI
D
Download sequence
Identical sequences A0A091MB56
XP_009704075.1.71050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]