SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MCC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MCC1
Domain Number 1 Region: 4-193
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.5e-52
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 195-319
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.79e-41
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000402
Further Details:      
 
Domain Number 3 Region: 371-475
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.26e-28
Family Ubiquitin-related 0.00074
Further Details:      
 
Domain Number 4 Region: 320-394
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000122
Family Ubiquitin-related 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MCC1
Sequence length 477
Comment (tr|A0A091MCC1|A0A091MCC1_CATAU) 2'-5'-oligoadenylate synthase-like 2 {ECO:0000313|EMBL:KFP57103.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_06975 OC=Cathartes.
Sequence
LRTVAPNKLDGWIAETLQPSTAFCRQVKQTVKKICDFLKEDCFETDIHVHKTVKGGSAGK
GTALQNNSDADVVLFLSCFSSYQEQKQERRNILNLIESRLHACRRSLTFTVNISEPRYKG
PGNTPRSLSLTLRSKETSESIEVDILPAYDALGQVSRDAPPDAEVYVQLLNASTDPGEFS
PCFTELQKKFVKRYPAKLKNLLRLVKYWYKELLKPQHPTADLPPKYALELLTIYAWEEGT
GSRDSFVTAEGFRTVLELLCRYQEICIYWEMYYSLQHSQIGAHVKRLLCSPCPVILDPAD
PTGILGPPKNWDLPARPVTIEVRQLGGTSLSMTVSPGTTVRQLKEQIEQMWGIPWYKQRL
GLQEPGRSALVLQDGETLATHGIFYNTVLMLLQTEPQAMEVFVKDDKNRTTTYTVRPSDT
VRQLKEQIHARQGPPANQQRLTYGSRELEDRHMLAHYDIQPRSTIFMLLRLRGGAGP
Download sequence
Identical sequences A0A091MCC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]