SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MD54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MD54
Domain Number 1 Region: 22-55
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000827
Family Fibronectin type I module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MD54
Sequence length 60
Comment (tr|A0A091MD54|A0A091MD54_CATAU) Prostate-associated microseminoprotein {ECO:0000313|EMBL:KFP57622.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_08714 OC=Cathartes.
Sequence
WGRLCLLLSLLLQMPGSQAKCYFQAKAPCEYEGKQFSLGESWLSTNCLLCTCLHPIGVGC
Download sequence
Identical sequences A0A091MD54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]