SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MF41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MF41
Domain Number 1 Region: 236-366
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-44
Family Regulator of G-protein signaling, RGS 0.000000217
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000419
Family DEP domain 0.048
Further Details:      
 
Domain Number 3 Region: 170-226
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000157
Family Transducin (heterotrimeric G protein), gamma chain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091MF41
Sequence length 377
Comment (tr|A0A091MF41|A0A091MF41_9PASS) Regulator of G-protein signaling 9 {ECO:0000313|EMBL:KFP71741.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_07246 OC=Acanthisitta.
Sequence
NDIVQWILQRLQITAEEALHLGDLFVKYGYIYPLQEPKNLTLKADGSLYRFQTPYFWPVQ
GWPADDTDYAIYLAKKNIKRKGVLEEYEKEHYNMLNQKINYKWDFIIMQAKEQYKAGKER
KKEDRYALDCQERAYWLVNRTPPGMLDVLEYGLDRVTDPNENKVNQKNTMEFFRREIIYY
QQAIMKTRVKSSVSLGGLVKYSEQFLSNDPILSGCLPSNPWITDDPDFWDLNAKLVEVPT
RMRVERWAFNFNELIRDPKGRQNFQLFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEE
IYKLFLAPGARRWINIDGTTMGITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPI
YKEMLAKAIVPQETVKK
Download sequence
Identical sequences A0A091MF41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]