SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MG45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MG45
Domain Number 1 Region: 54-186
Classification Level Classification E-value
Superfamily TNF-like 6.42e-36
Family TNF-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MG45
Sequence length 189
Comment (tr|A0A091MG45|A0A091MG45_9PASS) Complement C1q tumor necrosis factor-related protein 1 {ECO:0000313|EMBL:KFP73365.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03386 OC=Acanthisitta.
Sequence
VPLFLLVGEKGDRGEPGMPGKWGKEGPRGERGAQGQKGSKGQMGPAGDACKHQYAAFSVG
RKKALHSSEGFQVLIFDTVFVNLYSHFDMFNGKFYCSVGGLYYFSLNVHTWNFKETYMHI
MHNEEEAVILYAQPSDRSIMQSQSLMLELQENDEIWVRLYKRERENAIYSDDVDVYITFS
GYLVKPSLE
Download sequence
Identical sequences A0A091MG45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]