SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MI96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MI96
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-47
Family Hect, E3 ligase catalytic domain 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091MI96
Sequence length 138
Comment (tr|A0A091MI96|A0A091MI96_9PASS) E3 ubiquitin-protein ligase HECW1 {ECO:0000313|EMBL:KFP75013.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_10862 OC=Acanthisitta.
Sequence
LKSGGANTAVTEKNKKEYIERMVKWRVERGVVQQTEALVRGFYEVVDSRLVSVFDARELE
LVIAGTAEIDLNDWRNNTEYRGGYHDGHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSVP
YEGFAALRGSNGLRRFCI
Download sequence
Identical sequences A0A087VMU7 A0A091JS08 A0A091L2Q2 A0A091MI96 A0A091TXD3 A0A093ICF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]