SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MM53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MM53
Domain Number 1 Region: 2-255
Classification Level Classification E-value
Superfamily Annexin 2.62e-87
Family Annexin 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091MM53
Sequence length 256
Comment (tr|A0A091MM53|A0A091MM53_9PASS) Annexin A10 {ECO:0000313|EMBL:KFP77251.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_10972 OC=Acanthisitta.
Sequence
QTQGTIFPAPNFNPIMDAQLLGGALQGISCEKDVLIDILTQRCNSQRLMIAEAYRDMYGR
DLIADLKENLSHHFKEVMVGLMYPPASYDAHELWHALKGVDTEENCLIDILASRSNMEIF
QMKEAYLMQYNTDLQQDIDSETSGHFRDTLMNLAQGTRMEGYADPSTAAQDAMILWEACQ
RKTGEHKNMLQMILCNRSHQQLWIVFQEFQNISGQDIVDAINECYDGYFQELLVAIVLCI
RDKPSYFAYRLHKAIH
Download sequence
Identical sequences A0A091MM53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]