SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MMW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MMW3
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000318
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MMW3
Sequence length 56
Comment (tr|A0A091MMW3|A0A091MMW3_9PASS) SH2 domain-containing protein 7 {ECO:0000313|EMBL:KFP76498.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_12346 OC=Acanthisitta.
Sequence
RGKDRCRHYMIRMQANARYVILGEDRAHASLTELVRYYQTVGIRPFMEILTVPCGQ
Download sequence
Identical sequences A0A091MMW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]