SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MPU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MPU3
Domain Number 1 Region: 40-69
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MPU3
Sequence length 70
Comment (tr|A0A091MPU3|A0A091MPU3_9PASS) A disintegrin and metalloproteinase with thrombospondin motifs 10 {ECO:0000313|EMBL:KFP77521.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_04766 OC=Acanthisitta.
Sequence
GSQIQSVVCKKLSDGSIVSNHFCNSETKLSERQRSCNTEPCPPAWVIGNWSECSRSCNEG
VRTRSVFCKR
Download sequence
Identical sequences A0A091MPU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]