SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MQG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MQG8
Domain Number 1 Region: 287-432
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-23
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 524-650
Classification Level Classification E-value
Superfamily PX domain 1.19e-21
Family PX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MQG8
Sequence length 893
Comment (tr|A0A091MQG8|A0A091MQG8_9PASS) Sorting nexin-14 {ECO:0000313|EMBL:KFP77904.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_13299 OC=Acanthisitta.
Sequence
TPCVRRYLHILMLFWSFVAGVVTFYCSLGPDSLLPNVLFAISYRPKQVELPELFPQGHSC
AVCGKVKCKRHRPTLLLENYQPWLDLEVPSKVDASLSEVLELVLENFIYPWYRNITDDES
SVDELRGTLRFFASVLVRRIHKVDIPTVVTKKMLKAAMKHVEVIAKARQKVKNAEFLQQA
ALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKSTECRSLALLIREILPGSVFLP
SMDFLADPDTVNHLLLIFIDDSPPEIATEPTSSLVPFLQKFAEPRNKKPSVLKLELKEIR
DQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSDTEKMSLHEEVQKIYKTYC
LDESIDKIRFDPFIVEEIQKIAEGPYMDVVKLQTMRCLFEAYERVLSLLENVFTPMFCHS
DEYFRHLLRGAESPTRNSKFNRSSLSLDDLRTTQKRGESFGISKIGNKIKGVFKSSAMEG
AMLPNYNLNEGEDDFIEEGVMVMEDDSPEEAVTTPNTPRNLSAWNISIPYVDFFEDPSLE
RRDRKERIPVFCIDVERNDRQAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPS
KRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKMLPDVN
LGKIIKSVPGKLMKEKGQHLEPFIMNFINSCESPKPKPSRPELTILSPTSENNKKLFNEL
FKNNANRSENTERRQNQNYFMEVMTVEGVYDYLMYVGRVVFHIPDWLHHLLMGGRILFKN
TLELYTDYYLHHKLEQLFEEHRLVSLITLLRDAVFCENTEPRSLQDKQKRAKKTFEEMMR
YIPDLVGKCIGEEAKYEGIRLLFDGMQQPVLNKQLTYVLLDIGIQELFPELSK
Download sequence
Identical sequences A0A091MQG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]