SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MS02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MS02
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-44
Family Fibrinogen C-terminal domain-like 0.000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091MS02
Sequence length 108
Comment (tr|A0A091MS02|A0A091MS02_9PASS) Fibrinogen gamma chain {ECO:0000313|EMBL:KFP80253.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_02622 OC=Acanthisitta.
Sequence
DCQDIANKGARKSGLFFIKPQRAKQSFLVYCEIDSYGNGWTVFQRRLDGSEDFNKNWIQY
REGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYTLRIELEDWSGKKRY
Download sequence
Identical sequences A0A091MS02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]