SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MTA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MTA5
Domain Number 1 Region: 246-375
Classification Level Classification E-value
Superfamily ApaG-like 9.81e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 65-232
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-17
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 3 Region: 1-47
Classification Level Classification E-value
Superfamily F-box domain 0.00000916
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MTA5
Sequence length 420
Comment (tr|A0A091MTA5|A0A091MTA5_CARIC) F-box only protein 3 {ECO:0000313|EMBL:KFP64730.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_02900 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
SCCYLSRRLNQLSSHDPLWKRHCKKYWLISEEEKSQRNQSWKAIFISTYSDLGRYIRYYA
TLKKAWDDLEKYLGQRCPRMIGSLKESVREEDLDAVEAQIGCKLPDDYRCSFRIHNGQKL
VVPGLMGSMALSNHYRSEDLLDIDTAAGGFQQRLGLKQCLPLTFCIHTGLSQYMALESVE
GRNKYEIFYQCPDQMARNPSAIDMFITGTSYLEWFTSYVNKVVTGGYPIIRDQIFRYVHD
KECVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRIT
NAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHCLYYKDKFFNV
TIPRFHMVCPTFKVSTARMETNHNEYAVDEDEDSTDTDEYEDRRRVLDIPAPSGRCPRHT
Download sequence
Identical sequences A0A087VIA1 A0A091MTA5 A0A091UW07 A0A093R8S7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]