SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MWR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MWR7
Domain Number 1 Region: 168-319
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-41
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 36-160
Classification Level Classification E-value
Superfamily SEA domain 2.62e-22
Family SEA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MWR7
Sequence length 320
Comment (tr|A0A091MWR7|A0A091MWR7_9PASS) Transmembrane protease serine 11E {ECO:0000313|EMBL:KFP81112.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_04344 OC=Acanthisitta.
Sequence
IVIQMDRAVRRMEPWKIAVIVVSVIVGLALIIGLITYFLCNDQDRFYNASFLITNVNYDP
QYERQTTDEFRNLSEEIETMISEVFKGSFLSKRYIRSHVVSLSPDPGGVLASVVLVFKFP
SADSKTTTWGHVNRVLLRRLKTTSKYLEVDQSTIRLTELNKEKGDNLLNNCCGIRRQAFS
FTGVERITGGQRALDGEWPWQASIQLDGTHRCGASIISNIWLVTAAHCFKGVRDPRRWTA
SFGILLRPPKQKKFVRRIIIHERYGDVVLGHEHDVAVVELASAIEFTTDVHSVCLPEASH
IFPDNTSCFVTGWGALENDG
Download sequence
Identical sequences A0A091MWR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]