SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091N1D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N1D0
Domain Number 1 Region: 120-259
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.24e-48
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 319-423
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.98e-27
Family Ubiquitin-related 0.00097
Further Details:      
 
Domain Number 3 Region: 2-118
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.4e-25
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00049
Further Details:      
 
Domain Number 4 Region: 257-344
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000014
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091N1D0
Sequence length 425
Comment (tr|A0A091N1D0|A0A091N1D0_CARIC) 2'-5'-oligoadenylate synthase-like 2 {ECO:0000313|EMBL:KFP67590.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_08318 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
AGKGTALRNNSDADVVLFLSCFSSYQEQKQERTYILDLIKKRLHACKQSLKFTVNISEPR
YKGPGNTPRSLSLTLCSRQVIWDAPPDPGVYVGLLNASSEPGEFSPCFTELQKKFVKRYP
AKLKNLLRLVKHWYKEMLKPRYPTADLPPKYALELLTIYAWEEGTGSSNSFDMARGFRTV
LELLYRHREICIFWETYYSLQHSQIGAHVKRLLHRPRPVILDPADPTGILGQGKNWDLVA
QEAVHNLSLPCVSSVQPWDVQPSRPVTVEIRQLVGTSLSRTVSPSTTVQQLKEEIEQVWG
IPRYKQRLAQQEPSRNSLILQDGDTLATHGIFYSTMFVLLQTEPQPMEVFVKDDKNRTTT
YTVQPTDTVRELKEQIHKRGGPLADQQRLTYGSRELEDRHTLAHYDVQPKSTIFMLLRLR
GGTGP
Download sequence
Identical sequences A0A091N1D0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]