SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091N5K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N5K8
Domain Number 1 Region: 33-118
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000611
Family Snake venom toxins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091N5K8
Sequence length 156
Comment (tr|A0A091N5K8|A0A091N5K8_APAVI) Ly6/PLAUR domain-containing protein 6B {ECO:0000313|EMBL:KFP84676.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_03507 OC=Apaloderma.
Sequence
AFLPFFILSGNWVSAENINFYSVRPPLDPTPFPNSFKCFTCDNAVDNYNCNRWAEDRWCP
ESTQYCLTVHLFTDHGKSTSVTKKCATGEECHLVGCHRHRESGHTECVSCCEGMICNVEI
PTNHTNAVFAVLHARRTSGGSRRTVSVAVLVLVMMI
Download sequence
Identical sequences A0A091N5K8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]