SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091N904 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N904
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 101-201
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091N904
Sequence length 202
Comment (tr|A0A091N904|A0A091N904_9PASS) T-cell differentiation antigen CD6 {ECO:0000313|EMBL:KFP72790.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_04314 OC=Acanthisitta.
Sequence
ALHLVGGRSRCEGRVELEQEGTWGTVCDDGWDIPDADVVCRQLQCGYAISANGSATFGRG
QGPILLDEVGCKGHEEHLWECAAASEHDCSHKEDAGVVCSEHQEWRLSGGRDGCAGRVEV
FFHGTWSTVCDSTWYHLESEVLCHTLGCGKPLQSLSYGHTLPGKMLYECENFQPSLAQCQ
WIFNKSAPCHQSRAVGVICNGT
Download sequence
Identical sequences A0A091N904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]