SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NLH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NLH8
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-17
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 2 Region: 147-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000837
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091NLH8
Sequence length 260
Comment (tr|A0A091NLH8|A0A091NLH8_APAVI) R-spondin-1 {ECO:0000313|EMBL:KFP89952.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_06298 OC=Apaloderma.
Sequence
MQLGLFVVVVFLSSMDLTGSSKVVKGKRQRRISTELSQGCARGCDLCSEFNGCLRCSPKL
FILLERNDIRQIGICLPSCPLGYFGLRNTDMNKCIKCKIENCESCFSRNFCTKCKEGLYL
HKGRCYVTCPEGYSAANGTMECSSPAQCEMSEWGPWGPCSKKRKLCGFKKGNEDRTRRIL
QAPSGDVSLCPPTTEVRRCTVQKNQCPEGKRKKKEEQGKQDNANGNRNRKDTKDAKSGTK
RRKSKQRGAAVPTTSASPAQ
Download sequence
Identical sequences A0A091NLH8
XP_009869781.1.31609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]