SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NMI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NMI1
Domain Number 1 Region: 484-530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000101
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 555-620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000136
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 24-71
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 611-667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000025
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 76-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000193
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091NMI1
Sequence length 832
Comment (tr|A0A091NMI1|A0A091NMI1_APAVI) Complement component C7 {ECO:0000313|EMBL:KFP90601.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_09530 OC=Apaloderma.
Sequence
VLGIFLLLEVSGFFSIFSSPSPPVHCCWNSFGPWSECDGCTQKQIRRRMVAVYGQYGGNP
CLGDAFETRPCTPTRGCPTEDGCSDRFRCFSGQCISKSLVCNGDQDCEEDGADEDQCEEK
TTVCDIDKTPPNSELTGTGFDAITGETRGRVIHTKSFGGECRKVFSGDGREYYRLSESIL
AYTFQVKIQNDFSYEFFNSSWSYMKHTEKYEKSNSGHSYSQNKIVQHNQKSKQLMVVENS
VEVAQFINNRPDFLTLAEPFWKELANLPVFYEYNIYRRLIEHFGTHFLHSGSLGGHYKLI
FYMDTDKMKAEGMTITDMYQCTTSGWNAFIVKKRKVKCSKLDELLQTSSGSSGNKIKGDP
YIQGGSPGAVAGLSYLELNNPSGNSQRYSFWARSVTDYPRVIKQKLTPLYELVKEVPCSS
VKKHYLKQAIEEYMAENDPCKCQPCQNGGEVAMEGTQCVCYCKPYTFGAACELGTLVQDQ
PGVVDGHWNCWSSWSPCSGGRKSRSRTCNNPSPQGGGKACIGEQQESRPCEDEELQHLRL
IEPHCFDLSTSPTEFCSPPPFLENGFVQNAENSYPAGKSIVYACRHGYSLVGDPVAKCGS
NLQWQVGDRYCQETACLLPVLEGGLQGEPWKPVYEIGERVTLSCPHGMHLEGAHSILCEP
SLKWSPDIKTIQCKRSVPSVKTEVTDPKCQPWEKVHQSQCVCKMPYECGPSLDTCATDQR
TKRNTPLTVCKMHALECMGRKYSLTNAENCKIPQVAPLSCGSCRSWEKCDAQSNSCVCDE
DRPCEEGGIQICAEVSGSAARRTLSECEAGWLRCQGETVTLVSIRPCDIQSK
Download sequence
Identical sequences A0A091NMI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]