SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NTZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NTZ3
Domain Number 1 Region: 289-410
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-25
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 
Domain Number 2 Region: 499-635
Classification Level Classification E-value
Superfamily PX domain 1.31e-22
Family PX domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091NTZ3
Sequence length 844
Comment (tr|A0A091NTZ3|A0A091NTZ3_APAVI) Sorting nexin-25 {ECO:0000313|EMBL:KFP92607.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_12194 OC=Apaloderma.
Sequence
QFLVFTVLFLLSVFDYSYRDYILSWYGQLSRDEGQLYQLLSEDFWEVAKQLRQRLSHIDV
VKVVCNDVVKALLSHFCDLKGANARQEDPPRPFLLHPCLRSPDEEVRFLQKCSQILVYCL
LPSKDVQSVSLRIVLAELLATKVLKPVVELLSDPDYINRMLLSQLEYREQMNEHQKKDYT
YAPSYEEFIKLINSSSDVEFLKQLRYQIVVEIVQATTISNIPQVKRQKDSKGKETAAMKA
DLLRARNVKRYINQLTVAKKQCEKRIRLLGGPAYDQQEDGVSDEGEGPQGQKILQFDEIL
ANPSYREHFRIYMERMDKMALIGLWESVEYLKNANKAEIPQLVSEIYQNFFVESREIPVE
KSLYKEIQQSLVGNKGIEVFYRIQADVYETLKDRYYPSFIVSDLYEKSVKKEEERSSAQL
TPEDKDEVNQGCEEATEECSTRINEQASYAVNKLRQLNDKLEYKKQALNSICNSPKPDKK
IVSKLKDEITLMEREHSDLQLHIARTDWWCENLGMWKALIVSGEVLEENGEQVPCYSVMV
SLQEVGGAETKNWTVPRKLSEFQNLHRKLSECFSSLKKVQLPSLSKLPFKSIDQKFMEKS
KNQLNNFLQKLLSDERLCQSEALYAFLSPSPEHLKVIDVQGKKSSFSLSSFLERLPGDLF
SHQEEETEEDSDLSDYGEEVDGKRDSLAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTF
GRTINKQIRDTVHWMFSEPMLVYYIGVFRDAFWPNGKLAPPPRAKSDEQKQETKQRAQQK
LLENIPDTLQSLVGQQNARHGVVKVFNALQERKANKHLLYVLLELLLTELCPELRAHLEQ
LNAT
Download sequence
Identical sequences A0A091NTZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]