SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NU65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NU65
Domain Number 1 Region: 43-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000175
Family Tudor domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091NU65
Sequence length 225
Comment (tr|A0A091NU65|A0A091NU65_HALAL) Survival motor neuron protein {ECO:0000313|EMBL:KFP96907.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_11822 OC=Accipitrinae; Haliaeetus.
Sequence
KNALKNGECSETSDKPEQRLRMKRKNNKKNRNRKKSNAVPLKQWKVGDGCSAVWSEDGNV
YPATIASINQKRGTCVVTYMGYGNQEEQNLSDLLPLASDETVNGMGNSGENDNETPYSTD
ESEKSSQSPQSKNNCTKARFSPQNLHFPAPPAAPGLGRVSSALSEIIHIPLAPPLFLPFW
PPPFPAGPPLIPPPPPMRPDSEDDEALGSMLIAWYMSGYHTGYYL
Download sequence
Identical sequences A0A091NU65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]