SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NXC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NXC8
Domain Number 1 Region: 52-108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 399-455
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 339-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000106
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 513-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 5 Region: 458-513
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000798
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091NXC8
Sequence length 613
Comment (tr|A0A091NXC8|A0A091NXC8_HALAL) A disintegrin and metalloproteinase with thrombospondin motifs 6 {ECO:0000313|EMBL:KFP98249.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_04108 OC=Accipitrinae; Haliaeetus.
Sequence
EVCRELWCLSKSNRCVTNSIPAAEGTLCQTGSIEKGWCYQGECVPFGTWPQSIDGGWGPW
SIWGECSRTCGGGVSSSIRHCDSPAPSGGGKYCLGERKRYRSCNTDPCPSGARDFREKQC
ADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYNFYTERAPAVIDGTQCNADSLDICI
NGECKHVGCDNILGSDAKEDRCRVCGGDGSTCEAIEGFFNDSLPRGGYMEVIQIPRGSVH
IEIREVAMSKNYIALKSEEDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGP
TSENLIVMILLQEQNLGIRYKFNVPISRTGSGDNEVGFAWNHLPWSECSATCAGGVQRQE
VVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWSECSKTCDGGMRSRTV
LCIRKIGPSEEETLDNTNCLTHRPIEKEHCNNQSCPPQWVALDWSECTPKCGPGFKHRIV
LCKSSDLLKTFPAAQCQEESKPPVRIRCSLGRCPPPRWVTGDWGQCSAQCGLGQQMRTVQ
CLSYTGQASSECPETVRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRA
YFRQMCCKTCQGH
Download sequence
Identical sequences A0A091NXC8
XP_009928911.1.2804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]