SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P1U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P1U1
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-28
Family Reprolysin-like 0.0053
Further Details:      
 
Domain Number 2 Region: 636-692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000641
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 529-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 186-229
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000106
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 462-525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 587-631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091P1U1
Sequence length 756
Comment (tr|A0A091P1U1|A0A091P1U1_HALAL) A disintegrin and metalloproteinase with thrombospondin motifs 19 {ECO:0000313|EMBL:KFQ00690.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_05076 OC=Accipitrinae; Haliaeetus.
Sequence
LGIAYLSGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEW
IKGQNLGDVSWSRCSREDLERFLRSKASNCLLQTNPQSLNSVIIPSKLPGMTYTADEQCQ
ILFGPTASFCQEMQHVICTGLWCKVEGEKECKTKLDPPMDGTDCDTGKWCKAGECVNRTS
FAEHMEGEWSAWSTCSRTCNTGISSRQRKCPGSGLEGECHGPMMQYRVCKNPSCPAGVPA
FRDWQCQAFSVRSSYQKHVHQWQAVIDDEKPCALFCSPAGKDQPVLLTEKVMDGTSCGQH
GLDICADGRCQKFGCDGILGSLAREDHCGVCNGNGKSCKVIKGDFNHTRGAGYVEALVIP
AGARRIKVVEEKPAHSYLALRDAGKQSINSDWKIEHSGTFNIAGTTVHYVRRGLWEKISA
KGPTTSPLHLLVLLFHDQSYGLHYEYTIPLDPLPENQSSKVPEPLFMWTHSGWEDCDAVC
GGGERKTTVSCTKIMNKNISLVDNKKCKYLTKPEPQIRKCNEQPCQTRWMMTEWTPCSRT
CGKGTQNRQVACTQQLRNGTLIRARERDCLGPKPASAQRCEGQDCMTVWEAGVWSECSVK
CGKGVRHRTVRCTNPRKKCVLSTRPKEAEDCEDYSKCYVWRMGDWSKCSVTCGKGMQSRV
IQCMHKITGRHGNECFSSEKPAAYRPCHLHPCNEKINVNTITSPRLAALTFKCLGDQWPV
YCRVIREKNLCQDMRWYQRCCETCRDFYAQKMQQKS
Download sequence
Identical sequences A0A091P1U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]