SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P2M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P2M4
Domain Number 1 Region: 164-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-76
Family Protein kinases, catalytic subunit 0.00000138
Further Details:      
 
Domain Number 2 Region: 34-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.55e-34
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091P2M4
Sequence length 551
Comment (tr|A0A091P2M4|A0A091P2M4_9PASS) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_10707 OC=Acanthisitta.
Sequence
MCDMGGLDNLIANTAYLQARKSGEADAKEIQKRRKSLSLPKIEQCKEHRASLVADYESIC
EQQPIGKKFFRDFLETVPEYLVARDFLDEVSNWELAEDNIKSSTMENMVTNFLKEGSKNY
LAFMSSDLVSKCQAAAAKDYENIVNLAKEETKLFLKDKPFTDFQASPFYDKFIQWKVFEK
QPVTEKYFYEFRVLGKGGFGEVCAIQVKNTGKMYACKKLDKKRLKKKSGEKMALLEKEIL
EKVNSPFIVTLAYAYETKSHLCLVMSLMNGGDLKYHIYNIGERGLEMKRIIYYSAQITCG
ILHLHSINIVYRDMKPENVLLDDNGNCRLSDLGLAVRVKEGKAITQRAGTNGYMAPEILK
EEDYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVNKDEVKRRTLEDEVKFEHASFTEEAK
DICRLFLAKKKEDRLGSRNADDDPRKHKFFKTINFHRLEANLVDPPFVPDPSVVYAKDVA
DIADFSEVRGIDFDDKDKKFFKKFATGAVPIPWQEEIIETGLFEELNDPNRVDSGGYANG
GEAKSGVCLLL
Download sequence
Identical sequences A0A091P2M4
XP_009078307.1.14518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]