SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P2P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P2P6
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.92e-24
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 
Domain Number 2 Region: 207-344
Classification Level Classification E-value
Superfamily PX domain 7.19e-23
Family PX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091P2P6
Sequence length 552
Comment (tr|A0A091P2P6|A0A091P2P6_HALAL) Sorting nexin-25 {ECO:0000313|EMBL:KFQ01257.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_12840 OC=Accipitrinae; Haliaeetus.
Sequence
QILQFEEILANPSYREHFRIYMERMDKMALIGLWESVEYLKNANKAEIPQLVSEIYQNFF
VESRDIPVEKSLYKEIQQSLVGNKGIEVFYRIQADVYETLKDRYYPSFIVSDLYERSVKK
EEERSSAQLTPEDKDEVGQGCEEATEECSTRINEQASYAVNKLRQLNDKLEYKKQALNSI
CNSPKPDKKIVSKLKDEITLMEREHNDLQLHIARTDWWCENLGMWKAFIVSGEVLEENGE
QVPCYSVMVSLQEVGGAETKNWTVPRKLSEFQNLHRKLSECFPSLKKVQLPSLSKLPFKS
IDQKFMEKSKNQLNNFLQKLLSDERLCPSEALYAFLSPSPEHLKVIDVQGKKSSFSLSSF
LERLPGDLFSHQEEETEEDSDLSDYGEEVDGKRDSLAEPCFMLIGEIFELRGMFKWVRKT
LIALVQVTFGRTINKQIRDTVHWMFSEPMLVYYIGVFRDAFWPNGKLAPPPRAKSDEQKQ
ETKQRAQQKLLENIPDTLQSLVGQQNARHGVVKVFNALQERKANKHLLYVLLELLLTELC
PELRAHLEQLNA
Download sequence
Identical sequences A0A091P2P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]