SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P6U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P6U3
Domain Number 1 Region: 786-863
Classification Level Classification E-value
Superfamily DEATH domain 5.49e-22
Family DEATH domain, DD 0.0000118
Further Details:      
 
Domain Number 2 Region: 204-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000106
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 3 Region: 114-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000181
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 7-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000598
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091P6U3
Sequence length 865
Comment (tr|A0A091P6U3|A0A091P6U3_APAVI) Netrin receptor UNC5B {ECO:0000313|EMBL:KFP87280.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_12055 OC=Apaloderma.
Sequence
APAETLPHFLLEPQDAYIVKNKPVELVCRANPATQIYFKCNGEWVNQNDHVTKESLDEVT
GMLVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLG
KEVPLEHEVLLQCRPPEGVPQAEVEWLRNEDVIDPTQDTNFLITIDHNLIIKQARLLDTA
NYTCMAKNIVAKRRSTTAAVIVYVNGGWSTWSEWSPCNNRCGRGWQKRTRTCTNPAPLNG
GSFCDGQPFQKITCTTLCPGKSGSGDQSEASFSLPRLERDRDVSRNTMDLAPRNGGKDCA
GMLLDSKNCTDGLCLHMLDATGDVALYAGLVVAIFVFIVILMAVGVVVYRRRCRDFDADI
TDSSAALTGGFHPVNFKTSRHDNPQLLHPSMQPDLTASAGMYRGPMYALQDSSDKIPMTN
SPLLDPLPSLKIKVYNSSTASSSTGDNVRDGHFANARSKALGSQHLLSLPREHGNSASGT
FGYLGGRLTIPGTGVSLLVPHGAIPQGKFYEMYLVLNKAESALLPSEGTQTVLSPAVTCG
PTGLLLCRPVVLTIPHCADVDSSDWIYQLKTQSHQGNWEEVVTLDEETLNTPCYCQLEAK
SCHILLDQLGTYVFVGESYSRSAIKRLQLAIFAPTICTSLEYSLKVYCLEDTPDALKEVL
ELERTLGGYLLEEPKPLPFKDSYHNLRLSIHDIPHALWRSKLLAKYQEIPFYHIWSGSQR
ALHCTFTLERYSQASTELTCKICVRQVEGEGQIFQLHITLGEHASSFDTLRSHHSSATTT
QLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVLLDL
WEAEHQDDGDLNTLASALEEMGKSE
Download sequence
Identical sequences A0A091P6U3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]