SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P6Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P6Z0
Domain Number 1 Region: 141-404
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-70
Family Protein kinases, catalytic subunit 0.00000138
Further Details:      
 
Domain Number 2 Region: 15-164
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-47
Family Regulator of G-protein signaling, RGS 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091P6Z0
Sequence length 406
Comment (tr|A0A091P6Z0|A0A091P6Z0_LEPDC) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_03070 OC=Leptosomus.
Sequence
GGGGKRKGKSKKWKEILKFPHISQCEDLRRTLERDYCSICEKQPIGRLLFRQFCETRPEL
ECCIRFLDSVAEYEIAPDEKLGEKGKEIMMKYLTPESPAFVPEVSQDLIQQTEEKLENSP
CKELFSHCTKSVLDHLSGEPFQEYLNSMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGF
GEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKD
ALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENI
LLDDYGHIRISDLGLAVKIPEGESIRGRVGTVGYMAPEVLNNQRYTLSPDYWGLGCLIYE
MIAGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSICKMV
Download sequence
Identical sequences A0A091P6Z0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]