SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PB57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PB57
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Virus ectodomain 0.000000000473
Family Virus ectodomain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091PB57
Sequence length 42
Comment (tr|A0A091PB57|A0A091PB57_9PASS) Uncharacterized protein {ECO:0000313|EMBL:KFP88750.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03155 OC=Acanthisitta.
Sequence
AIDFMLLAQGHGCEDFEGMCCMNLSDHSESLYAIKQKLRENV
Download sequence
Identical sequences A0A091PB57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]