SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PBB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PBB3
Domain Number 1 Region: 132-253
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-25
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 257-296
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000445
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PBB3
Sequence length 323
Comment (tr|A0A091PBB3|A0A091PBB3_HALAL) Suppressor of cytokine signaling 7 {ECO:0000313|EMBL:KFQ04631.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_01948 OC=Accipitrinae; Haliaeetus.
Sequence
LISNRKHRLTRTQSAFSPVVFSPLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSL
LDDISGTLPTSVLVGPMGSSLQSFPLPPPPPPHAPDAFPRIVPLRPMEATPGQPAPHLQC
PLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSF
RSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGL
PPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQE
EVYLSLKEAQLISKQKQETESST
Download sequence
Identical sequences A0A091PBB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]