SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PI56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PI56
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.71e-38
Family Platelet-derived growth factor-like 0.00000923
Further Details:      
 
Domain Number 2 Region: 126-173
Classification Level Classification E-value
Superfamily Heparin-binding domain from vascular endothelial growth factor 6.41e-22
Family Heparin-binding domain from vascular endothelial growth factor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091PI56
Sequence length 173
Comment (tr|A0A091PI56|A0A091PI56_APAVI) Vascular endothelial growth factor A {ECO:0000313|EMBL:KFP91160.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_08999 OC=Apaloderma.
Sequence
LLVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFKPSCVPLMRCAGCCGDEGLECVPV
DVYNVTMEIVRIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKRGKGKGQKRKRK
KGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNERTCR
Download sequence
Identical sequences A0A091PI56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]