SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PJB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PJB2
Domain Number 1 Region: 1109-1195
Classification Level Classification E-value
Superfamily Immunoglobulin 9.86e-21
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 734-790
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 3 Region: 1024-1100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 899-966
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-16
Family I set domains 0.03
Further Details:      
 
Domain Number 5 Region: 8-59
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 6 Region: 346-404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 403-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 284-340
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 465-521
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000667
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PJB2
Sequence length 1246
Comment (tr|A0A091PJB2|A0A091PJB2_APAVI) Papilin {ECO:0000313|EMBL:KFP91590.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_11054 OC=Apaloderma.
Sequence
RMKRQIDVWGSWGEWGKCSRSCGGGVSFRQRHCYSQRTEGASSCVGPARSYRSCNVQSCP
EGSRDFRAEQCAEFDGTEFQGKKYKWLPYYGAPNKCELNCIPKGENFYYRHKEAVVDGTT
CEPGKRDICVEGVCQAVGCDNMLESAKKEDKCLQCGGDGSTCYAVQGTFDMPSLPKGYNQ
IFIIPMGATSIQIKEVMPSRNFLAVKNVRGEYYLNGHWTIDFSRALQVASTVMHYDRGSE
GDLAPELLRARGPTTEPLVIELISQEPNPGVQYEYYLPVQGQTSGYSWSYGSWSECSSEC
GGGFQSRLVFCTIDNEIYPDYMCRNKPQPDNNRTCGHQICPQTKRWKTGEWGSCSATCGG
GTQTRSVYCVAFDGQSSQGVVDNAECMAFAQQPRSSQPCNLRQCATWSTGPWSECSASCG
EGVRTRTVICRTQQGSPAQDFACLMEPKPSATQPCLKENCIQEIGWHIGDWGLCSKSCNS
GIRTRQVICADGDSKFYSPETCKAIQPQKPTTLGSCNVQPCHLPQQVPSMQDTMGYDVTR
QSSLTRYDPNSPATDSDDERLHPGSSVIHSTSGDHHIPPTNGRGINLLPVRWESQSRSSG
SHQLSVSQDSTAGTDSQNCHQSPHGCCPDGRTPASGPLGRGCPFSTCHRNRYGCCPDGVS
AAQGPNNMGCPQYPRDVQVIRNQPTLATPTASQALSQQHPSSECRGSVYGCCFDNVASAS
GPQGEGCLDRPNYPYPVICLLPSAHGPCTNWTTRWYFVTVVGKCNRFWYGGCHGNKNSFA
SEEECMRVCHSSGGVSPLENQPSSGTGALQHQYVESRSRTGSAQEKQGSSDQHVPTREGN
QWHKAFGAEVSMAEGFGQQTSADSFPVRALHRGPRREEGSRGASEITFSFRAILEEAKPS
LVTAAVGQNIQLVCKTAMSPFSRVEWMKDGRPVSSDRHTYHSDSSLVISHVKPEDAGTYT
CLISDGRTESRQIRLQIIEGERGQVLQKENQRHREISRGRSVAQAAGSSVHQQFTYRLRM
DKSEPSVVEANIGERVRLPCTVEASPALTTEWQKDGQPLSSPRHRQQSDGALVISRVSSE
DVGLFTCIASNGRDQDQRQVLFRPLGELRITGLLPSITVPEGGTAQLHCTVIGNNVNIRW
SRNGVPMRADGHHIHLSQDGSLMISNVQEADEGSYTCSAYSSSSSVSASTEVKVLRSNPS
TTASHVVDLSRECVDQPHLANCDLILQAQLCGNGYYSSFCCASCAR
Download sequence
Identical sequences A0A091PJB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]