SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PNB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PNB5
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-26
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 200-254
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 513-566
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PNB5
Sequence length 566
Comment (tr|A0A091PNB5|A0A091PNB5_LEPDC) A disintegrin and metalloproteinase with thrombospondin motifs 5 {ECO:0000313|EMBL:KFQ08826.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_02241 OC=Leptosomus.
Sequence
QDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFCE
ENFGSMEDKRLMSSILTSIDASKPWSKCTSATITEFFDDGHGNCLLDQPRKQILGPEELP
GQTYDAIRQCKLAFGPEYTVCPGMDVCSRLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRI
CLQGKCVDKTKKKYYSASSHGNWGSWGPWGQCSRTCGGGVQFAYRHCNNPAPRNNGRYCT
GKRAIYRSCNVTPCPANAKSFRQEQCEARNGYQSDAKGVKTFVEWVPKYAGVLPGDVCKL
TCRAKGTGYYVVFSQKVTDGTECRPYSNSVCVRGKCIRTGCDGIIGSKLQYDKCGVCGGD
NSSCTKVMGTFTKKSKGYTDVVKIPEGATHIKVRQFKTKDQSRFTAYLALKKKNGEYLVN
GKYMISTSETIIDINGTVMNYSGWSHKDDFLHAMGHSATKEVLIVQILATDPTQPVDVRY
SFFVPKKQGQMTNSVTSSGSSSSSKVTPQLTQPRWVTGPWLSCSRTCDTGWHTRTVQCKD
GHGKLAKGCLLSQRPSAFKQCLLKKC
Download sequence
Identical sequences A0A091PNB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]