SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PRX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PRX3
Domain Number 1 Region: 127-183
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 1213-1270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 564-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 968-1021
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 627-699
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 1340-1404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 1092-1146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 704-757
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 9 Region: 297-350
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000123
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 1268-1318
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000798
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 1020-1091
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 358-443
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 13 Region: 835-889
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000785
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PRX3
Sequence length 1587
Comment (tr|A0A091PRX3|A0A091PRX3_LEPDC) Thrombospondin type-1 domain-containing protein 7A {ECO:0000313|EMBL:KFQ10028.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_13678 OC=Leptosomus.
Sequence
GPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLPTNCKQPERPDNQQSCFRVCDWHKELYD
WQIGSWNQCRPVLSRSHEKPLECLRGEEGIQTRDITCIQKANGVPAEDVICEYFEPKPRQ
EQACLIPCRQDCIVAEFAPWSECSKTCGNGLQHRTRHVVAPPQFGGSACPNLTEFQICQS
SPCAAEESLYSLNVGPWSACSVPHSRQIRQARKRGKNKDKEKDREKAVRDPEARELIKKK
RNRNRQNRQENKYWDIQIGYQTRQVTCTHRNGKTAALSFCQQDKLPITFQSCVITKECQV
TEWSEWTPCSKTCFDMTTPKGNRTRSRAIKQLPIGSESECPPLEEAEQCVSQGDGVAPCI
TYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGVQTREVYCVQANENLLSYLNTLKEK
EASRPVDRRLCTGPLPSTSQLCHIPCPTECETSAWSAWGPCTYESCDDPQAKKGFKLRKR
RITNEPTGGTGNCPHLLEAIPCEEPSCYDWRITGLEECIPDNEKPCGPGTQVPVVVCVNS
DGEEVDRQLCRDAIYPIPVVCEAPCPKDCVLSVWSAWSSCSHTCSGKTTEGKQMRARSVL
AYAGEGGIQCPNSSALQETRSCNEHSCTVYHWQTGPWGQCIEDTSVSAFNSSASWNGEAT
CSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCRKDCIVTPFSDWTLCPSSC
EEGGVTVRKQSRHRVIIQLPANGGRECPDSLFEEKECEASPVCYSYRWKTHKWRRCQLVP
WYVRQDSPGAHETCGPGLQARAITCRRQDGGQADITECLKYSGPLPSLTQTCQIPCQDDC
QFTNWSKFSSCNGDCGGVRTRKRSLVGKSKKRDKCKNSQLYPLIENQFCPCDKYSAQPVG
NWSDCILPEGKLEVLLGMKVQGDVKECGQGYRYQAMACYDQNNRLVETSRCNSHGYIEEA
CIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQVYEVVP
CHSDCSQYVWVTEPWSVCKVTNVDLKENCGEGVQTRKVRCMLNTADGPSDTVEDYLCDPE
EMPLGARKCTLPCPEDCVMSEWGSWSRCSLPCNGSSVRERSAESLRQPDDGKSCPAATET
EVCTLNKNCYHYDYNVTDWSTCQLSEKAVCGSGIKTRMLDCVRSDGKSVDLKYCEELGLE
KTWQMNMSCVVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTINQPFQGDGRPCPSQME
QFKPCPVKPCYRWQYGQWSACKVEDAQCGEGTRARNISCVVFDGSVEDVGKVVDEEFCGE
IEQIIDGNKKMILEETCTVPCPGDCYLREWSEWSLCQLTCVNGEDLGFGGIQVRSRAVII
QELENQHLCPEQALETRPCDDGQCYEYKWMASPWKGSSRTVWCQRSDGLNVTGGCLVMRQ
PDADRSCNPPCSQPHAYCSETRTCSCEDGYTEVMSSDGTLDQCTLIPVVVIPTMEDKKGD
VKTSRAVNPTQPSSNQSGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIVSMIYLAC
KKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences A0A091PRX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]