SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PTP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PTP4
Domain Number 1 Region: 167-509
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-84
Family Protein kinases, catalytic subunit 0.000000301
Further Details:      
 
Domain Number 2 Region: 14-164
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.19e-44
Family Regulator of G-protein signaling, RGS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091PTP4
Sequence length 542
Comment (tr|A0A091PTP4|A0A091PTP4_HALAL) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_05273 OC=Accipitrinae; Haliaeetus.
Sequence
GGGGNRKGKSKKWRQMLQFPHISLCEDLRQTLERDYHSLCEKQPIGHMLFRQFCETRPEL
SRCVKFLDAVAGYEVAPDEKRKECGQHLIEKYLKPNSEDHVPEVPSQLVDACCERLEQEP
SKELFKESTKLIHDYLSVAPFADYLDSLYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGF
GEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKD
ALCLVLTLMNGGDLKFHIYHMGEAGFEEPRAAFYAAEICCGLEDLHQERIVYRDLKPENI
LLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNERYTFSPDWWALGCLVYE
MIEGQSPFQQRKKKIKREEVERLVKEVQEEYSEKFSPCARSLCTMLLCKDPLERLGCRGA
GAKEVKEHPLFKHLNFRRLEAGMLDPPFKPDPQAIYCKDVLDIEQFSTVKGVELEPTDND
FYQKFATGSVPIPWQNEMIETECFKELNVFSTDGMVPPDLDWKGQPSPQPKKGLLQRLFS
RQ
Download sequence
Identical sequences A0A087VJU9 A0A091PTP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]