SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091Q012 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091Q012
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.14e-47
Family Regulator of G-protein signaling, RGS 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091Q012
Sequence length 134
Comment (tr|A0A091Q012|A0A091Q012_LEPDC) Regulator of G-protein signaling 2 {ECO:0000313|EMBL:KFQ13527.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_14385 OC=Leptosomus.
Sequence
PSFCRPSPEEAQLWSEAFDELLANKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQ
KLTSKAKKIYNDFIEKEAPKEINIDFQTKNMIAQNIQEATHTCFSAAQKRVYSLMENNSY
PRFLESEFYQELCK
Download sequence
Identical sequences A0A091Q012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]