SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091Q183 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091Q183
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.36e-45
Family Reprolysin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 283-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-16
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 635-676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 596-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091Q183
Sequence length 679
Comment (tr|A0A091Q183|A0A091Q183_LEPDC) A disintegrin and metalloproteinase with thrombospondin motifs 1 {ECO:0000313|EMBL:KFQ13286.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_09624 OC=Leptosomus.
Sequence
GSGLKHYLLTLLSVAAKLYKHPSIRNSISLVVVKIMVIYEERKGPDISSNAALTLRNFCS
WQKQHNPPSDRHAEHYDTAILFTRQDLCGAKTCDTLGMADVGTVCDLNRSCSIIEDDGLQ
AAFTTAHELGHVFNMPHDDAKQCAGINGISRDFHMMASMLSNLDRSQPWSPCSAYMITTF
LDNGHGECLLDKPHKPIQLPSDLPGTLYDANRQCQFTFGDESKHCPDAASTCTTLWCTGT
SGGLLVCQTKHFPWADGTSCGEGKWCMNGKCVNKTEKKHYDTPVHGSWGSWGAWGECSRT
CGGGVQYSFRECDNPVPRNGGKYCEGKRVQYRSCNIEDCPDNDGKTFREEQCEKHNEFSK
SPFGSGPAVEWTPKFAGVSPKDRCKLVCRAKGTGYFFVLQPKVVDGTPCSPDSTSVCVQG
QCVKAGCDRMIGSNKKFDKCGICGGNGSTCKKVSGTLVRAKPGYHDVVTIPAGATNIEVK
QRNHRGARHDGSFLAIKAADGTYILNGDYTLSTLEQDITYKGSVLRYSGSSAALERIRSF
SPLKEPLTIQVLTVGDLPQPKIKFTYFVKKPTQPGSEKAPGRKKESFNAIKEIISSEWVI
EEWGECSKSCGAGWQRRAVECRDLRELKPSDVRPCADVPCPQWQLGDWSPCSKTCGKGFK
KRLLKCISYDGSVLPQESC
Download sequence
Identical sequences A0A091Q183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]