SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091Q1F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091Q1F3
Domain Number 1 Region: 555-620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 484-530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 24-71
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 611-668
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000334
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 76-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000169
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091Q1F3
Sequence length 832
Comment (tr|A0A091Q1F3|A0A091Q1F3_LEPDC) Complement component C7 {ECO:0000313|EMBL:KFQ13785.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_03578 OC=Leptosomus.
Sequence
VLGIFLLLEVSGFFSIFSSPSPPVHCRWNSFGPWSECDGCTQKQIRRRTVAVYGQYGGNP
CSGDAFETRPCTPTRGCPTEDGCGDRFRCFSGQCISRSLVCNGDQDCEEDGADEDRCEEK
TTVCDTDKTPPNSELTGTGFDAVTGETRGRVIHTKSFGGQCRKVFSGDGREYYRLSESVL
AYTFQVKIQNDFSYEFFNSSWSYMKHTERYEKSNSGHSYSQNKILQHSQKSKQLMVVENS
VEVAQFINNRPDFLTLAEPFWKELANLPVIYEYNIYRRLIEHFGTHFLHSGSLGGHYKVI
FYMDTDKMKAEGMSITDMYQCTTSGWNAFIVKKKKVKCSKLDELLQTSSGSSGNKIKGDP
YIEGGSPGAVAGLSYLELNNPAGNSQRYSFWARSVTDHPRVIKQKLTPLYELVKEVPCSS
VKKHYLKQAIEEYMAENDPCKCQPCQNGGEAAVEGTQCVCYCKPYTFGAACELGTLLQDQ
PGVVDGHWSCWSSWSSCSRARKARSRTCNNPSPVGGGKGCVGQQHESRPCEDEELQHFRL
IEPHCFDLSITPTEFCSAPPLLENGFVQNAENSYPVGKSIVYACRHGYSLVGDPVAKCGS
NLQWQVGDRYCQETACLLPVLEGGLQGEPWKPMYEIGERITLSCPHGMHLEGARSILCEP
SLKWSPDMRTIQCKKPVPSVKPEVTEPKCQPWEKVHQSQCVCRMPYECGPSLDTCATDQR
TKRNTPLTVCKMHALECMGRKYSLTNAENCKIPQTAEISCGSCRSWEKCDAQSNSCVCDE
DRLCEEGGIQICAEVRGSAAHRTMTECEAGRLKCQGETVILVSIRPCDVRSK
Download sequence
Identical sequences A0A091Q1F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]